Explore
Upload

DocSlides is a free service to upload presentations and documents.

Upload Now

Search Results for 'Patients Syndrome'

Patients Syndrome published presentations and documents on DocSlides.

Isolation antimicrobial susceptibility of Shigella from patients with acute gastroenteritis in western Nepal Godwin Wilson Joshy M

Isolation antimicrobial susceptibility of Shigella from patients with acute gastroenteritis in western Nepal Godwin Wilson Joshy M

  • natalia-silvester
  • 6 Slides

Easow Chiranjoy Mukhopadhyay PG Shivananda Depar...

Review of guidelines for the prevention and treatment of infection in patients with an absent or dysfunctional spleen Prepared on behalf of the British Committee for Standards in Haematology by a Wor

Review of guidelines for the prevention and treatment of infection in patients with an absent or dysfunctional spleen Prepared on behalf of the British Committee for Standards in Haematology by a Wor

  • ellena-manuel
  • 10 Slides

Davies Michael P N Lewis Jennie Wimperis Imran Ra...

EBOLA RESPONSE ROADMAP SITUATION REPORT SUMMARY s D h E E d d d DD Dd s D K Interventions to cont ain the disease in the three most affected countries includ isolating and treating patients

EBOLA RESPONSE ROADMAP SITUATION REPORT SUMMARY s D h E E d d d DD Dd s D K Interventions to cont ain the disease in the three most affected countries includ isolating and treating patients

  • jane-oiler
  • 14 Slides

In the three most affected countries 19 of 53 pla...

SPEECH AND LANGUAGE RESOURCE GUIDE For Parents of SchoolAge Children with Down Syndrome y Libb y K umin Ph

SPEECH AND LANGUAGE RESOURCE GUIDE For Parents of SchoolAge Children with Down Syndrome y Libb y K umin Ph

  • luanne-stotts
  • 4 Slides

D C C SLP Founder The Center for the Study of Sp...

Influence of the Nonergot Dopamine Agonist Piribedil on Vigilance in Patients With Parkinson Disease and Excessive Daytime Sleepiness PiViCogPD An Week Randomized Comparison Trial Against Pramipexole

Influence of the Nonergot Dopamine Agonist Piribedil on Vigilance in Patients With Parkinson Disease and Excessive Daytime Sleepiness PiViCogPD An Week Randomized Comparison Trial Against Pramipexole

  • danika-pritchard
  • 7 Slides

Oertel MD In Cooperation With the German Competen...

Risk and Learning in Impulsive and Nonimpulsive Patients With Parkinsons Disease Atbin Djamshidian MD Ashwani Jha MBChB Sean S

Risk and Learning in Impulsive and Nonimpulsive Patients With Parkinsons Disease Atbin Djamshidian MD Ashwani Jha MBChB Sean S

  • marina-yarberry
  • 8 Slides

OSullivan MRCPI Laura SilveiraMoriyama MD PhD Cla...

Am I adequately covered for private hospital care Will my private health insurance cover me for private hospital care when I need it Some patients are surprised to nd that they are not fully covered

Am I adequately covered for private hospital care Will my private health insurance cover me for private hospital care when I need it Some patients are surprised to nd that they are not fully covered

  • pamella-moone
  • 4 Slides

They may not be covered for things like cardiac s...

Authority to Administer ImmunizationsVaccines Name of Pharmacist Name of the Pharmacy or elsewhere Medication Dose Route Medication Class Medication Dose Route Authority to Administer Immuni zations

Authority to Administer ImmunizationsVaccines Name of Pharmacist Name of the Pharmacy or elsewhere Medication Dose Route Medication Class Medication Dose Route Authority to Administer Immuni zations

  • natalia-silvester
  • 5 Slides

MEDICARE PATIENTS

Appendix Pittsburgh Agitation Scale Patients Name Raters Name Patient Date Time AMPM to AWPM Hours of sleep this rating period Circle only the highest intensity score for each behavior group that y

Appendix Pittsburgh Agitation Scale Patients Name Raters Name Patient Date Time AMPM to AWPM Hours of sleep this rating period Circle only the highest intensity score for each behavior group that y

  • pasty-toler
  • 1 Slides

Use the anchor points as a guide to choose a suit...

The NHS Minor Ailment Se rv ic at your loca l ph ar ma cy Information for patients ADVICE What is the NHS Minor Ailment Service The Minor Ailment Service is an NHS service for children people aged

The NHS Minor Ailment Se rv ic at your loca l ph ar ma cy Information for patients ADVICE What is the NHS Minor Ailment Service The Minor Ailment Service is an NHS service for children people aged

  • jane-oiler
  • 8 Slides

When you are registered for the Minor Ailment Ser...

Product Description Liko Amputee Sling is a safe easytouse sling that has been specially designed as an aid to lifting patients with high doublesided leg amputations

Product Description Liko Amputee Sling is a safe easytouse sling that has been specially designed as an aid to lifting patients with high doublesided leg amputations

  • ellena-manuel
  • 6 Slides

We also recommend Amputee Sling for patients who ...

ANESTHESIA YOU nesthesia for mbulatory urgery oday the majority of patients who undergo surgery or diagnostic tests do not need to stay overnight in the hospital

ANESTHESIA YOU nesthesia for mbulatory urgery oday the majority of patients who undergo surgery or diagnostic tests do not need to stay overnight in the hospital

  • marina-yarberry
  • 10 Slides

In most cases you will be well enough to complete...

Articles submitted for publication to the Annals of Pharmacotherapy should advance the safe effective and economical use of medications in patients

Articles submitted for publication to the Annals of Pharmacotherapy should advance the safe effective and economical use of medications in patients

  • danika-pritchard
  • 5 Slides

Manuscript Submission Submission should be made a...

Elective Clinical Target Volumes in Anorectal Cancer An RTOG Consensus Panel Contouring Atlas R Myerson M Garofalo Iel Naqa R Abrams A Apte W Bosch P Das L Gunderson T Hong J Kim C Willett

Elective Clinical Target Volumes in Anorectal Cancer An RTOG Consensus Panel Contouring Atlas R Myerson M Garofalo Iel Naqa R Abrams A Apte W Bosch P Das L Gunderson T Hong J Kim C Willett

  • liane-varnes
  • 10 Slides

For patients receiving radiotherapy for anal or r...

Is Apathy a Valid and Meaningful Symptom or Syndrome in Parkinsons Disease A Critical Review Kathleen Rives Bogart Tufts University Objective To review the nearly papers suggesting that apathy may o

Is Apathy a Valid and Meaningful Symptom or Syndrome in Parkinsons Disease A Critical Review Kathleen Rives Bogart Tufts University Objective To review the nearly papers suggesting that apathy may o

  • alida-meadow
  • 15 Slides

Method Literature review Results The review revea...

REVIEW Apathy A Common Psychiatric Syndrome in the Elderly Shinya Ishii MD Nancy Weintraub MD and James R

REVIEW Apathy A Common Psychiatric Syndrome in the Elderly Shinya Ishii MD Nancy Weintraub MD and James R

  • alida-meadow
  • 13 Slides

Mervis MD Apathy or a lack of motivation has been...

APATHY INVENTORY IA The principle of the Apathy Inventory IA is to obtain information on the presence of apathy in patients with brain disorders

APATHY INVENTORY IA The principle of the Apathy Inventory IA is to obtain information on the presence of apathy in patients with brain disorders

  • conchita-marotz
  • 6 Slides

The Apathy Inventory is composed of 3 versions Ca...

CURRENT REVIEWS Appendage Obliteration to Reduce Stroke in Cardiac Surgical Patients With Atrial Fibrillation Joseph L

CURRENT REVIEWS Appendage Obliteration to Reduce Stroke in Cardiac Surgical Patients With Atrial Fibrillation Joseph L

  • celsa-spraggs
  • 5 Slides

Blackshear MD and John A Odell FRCSEd Division of...

Perioperative use of lowdose aspirin The following guidance was published in a review of perioperative medication in patients with cardiovascular disease Lowdose aspirin induces an irreversible inac

Perioperative use of lowdose aspirin The following guidance was published in a review of perioperative medication in patients with cardiovascular disease Lowdose aspirin induces an irreversible inac

  • liane-varnes
  • 1 Slides

There is no absolute consensus about whether or n...

Increased expression of ADAM protein in asthmatic patients as compared to nonasthmatic controls Priya Tripathi Shally Awasthi Nuzhat Husain Rajendra Prasad Vikas Mishra Departments of Pediatrics P

Increased expression of ADAM protein in asthmatic patients as compared to nonasthmatic controls Priya Tripathi Shally Awasthi Nuzhat Husain Rajendra Prasad Vikas Mishra Departments of Pediatrics P

  • sherrill-nordquist
  • 8 Slides

ADAM33 57347KDV57347EHHQ57347LGHQWL57535HG57347DV...

Therapies for Children With Autism Spectrum Disorders A Review of the Research for Parents and Caregivers Is This Guide Right for the Child in My Care Yes if e child you care for is between and ye

Therapies for Children With Autism Spectrum Disorders A Review of the Research for Parents and Caregivers Is This Guide Right for the Child in My Care Yes if e child you care for is between and ye

  • alexa-scheidler
  • 16 Slides

Asperger Syndrome Pervasive Developmental Disorde...

DRUGS TO BE AVOIDED BY CONGENITAL LONG QT PATIENTS Crediblemeds

DRUGS TO BE AVOIDED BY CONGENITAL LONG QT PATIENTS Crediblemeds

  • cheryl-pisano
  • 2 Slides

org is your trusted partner providing reliable inf...

Update of the Battered Woman Syndrome Critique August Page of The production and dissemination of this publication was supported by Cooperative Agreement Number UVCE from the Centers for Disease C

Update of the Battered Woman Syndrome Critique August Page of The production and dissemination of this publication was supported by Cooperative Agreement Number UVCE from the Centers for Disease C

  • lois-ondreau
  • 13 Slides

Its contents are solely the responsibility of the...

A prospective randomised controlled study examining binaural beat audio and preoperative anxiety in patients undergoing general anaesthesia for day case surgery R

A prospective randomised controlled study examining binaural beat audio and preoperative anxiety in patients undergoing general anaesthesia for day case surgery R

  • jane-oiler
  • 4 Slides

Padmanabhan A J Hildreth and D Laws 1 Specialist ...

Family Caregivers Difficulties in Caring for Bedridden Stroke Patients Yataa Baml nmeli Hastalara Bakm Veren Hasta Yaknlarnn Yaadklar Glkler Aratrma Salk Bilimleri Fakltesi Hemirelik Dergisi Yard

Family Caregivers Difficulties in Caring for Bedridden Stroke Patients Yataa Baml nmeli Hastalara Bakm Veren Hasta Yaknlarnn Yaadklar Glkler Aratrma Salk Bilimleri Fakltesi Hemirelik Dergisi Yard

  • debby-jeon
  • 15 Slides

Do57575 Dr Sevgisun KAPUCU Yard Do57575 Dr Sevin5...

Verge WVXVWDQFXVHWREHLWFK Male and Female Perceptions of Premenstrual Syndrome Hannah Gross Eskin KHSKUDVHWPXVWEHWKDWWLPHRIWKHPRQWKLVHFKRHGWKURXJKRXWSRSXODUFXOWXUHDQG in daily interactions between p

Verge WVXVWDQFXVHWREHLWFK Male and Female Perceptions of Premenstrual Syndrome Hannah Gross Eskin KHSKUDVHWPXVWEHWKDWWLPHRIWKHPRQWKLVHFKRHGWKURXJKRXWSRSXODUFXOWXUHDQG in daily interactions between p

  • phoebe-click
  • 21 Slides

It refers to t he common belief that DOO57347ZRPH...

Effect of extracorporeal magnetic energy stimulation on bothersome lower urinary tract symptoms and quality of life in female patients with stress urinary incontinence and overactive bladder TsiaShu

Effect of extracorporeal magnetic energy stimulation on bothersome lower urinary tract symptoms and quality of life in female patients with stress urinary incontinence and overactive bladder TsiaShu

  • liane-varnes
  • 7 Slides

Material and Methods A retrospective review was c...

What I need to know about Irritable Bowel Syndrome Irritable Bowel Syndrome U

What I need to know about Irritable Bowel Syndrome Irritable Bowel Syndrome U

  • briana-ranney
  • 24 Slides

S Department NATIONAL INSTITUTES OF HEALTH of Heal...

Short Bowel Syndrome and Crohns Disease Short Bowel Syndrome and Crohns Disease Short Bowel Syndrome sometimes referred to as SBS is a disorder that aects people who have had large portions of their

Short Bowel Syndrome and Crohns Disease Short Bowel Syndrome and Crohns Disease Short Bowel Syndrome sometimes referred to as SBS is a disorder that aects people who have had large portions of their

  • kittie-lecroy
  • 12 Slides

Approximately 1000020000 people in the United Sta...

Bra Measurements Information for Patients The perfect fit One of the most common causes of breas t pain and discomfort is due to an ill fitting bra

Bra Measurements Information for Patients The perfect fit One of the most common causes of breas t pain and discomfort is due to an ill fitting bra

  • myesha-ticknor
  • 4 Slides

A recent study showed that 8 out of 10 women wear...

Patients with claustrophobic anxiety are more likely to be frightened and experience a feeling of confinement or being closed in during MR imaging

Patients with claustrophobic anxiety are more likely to be frightened and experience a feeling of confinement or being closed in during MR imaging

  • stefany-barnette
  • 15 Slides

Those anxious patients have been reported to expe...

Natural supplements herbs vitamins and food o some prevent blood clots By Beth Waldron MA and Stephan Moll MD Patients who have ended their recommended course of prescription anticoagulation treatmen

Natural supplements herbs vitamins and food o some prevent blood clots By Beth Waldron MA and Stephan Moll MD Patients who have ended their recommended course of prescription anticoagulation treatmen

  • alida-meadow
  • 17 Slides

Since more than half of adults in the United Stat...

J Neural Transm tSupptl SpringerVerlag Disorders of motor development clumsy child syndrome H

J Neural Transm tSupptl SpringerVerlag Disorders of motor development clumsy child syndrome H

  • tatyana-admore
  • 18 Slides

Sigmundsson Research Group for Child Deveropmenr ...

Dyspraxia Beyond the Clumsy Child Syndrome Compilation Yvonne Tan Photos stock

Dyspraxia Beyond the Clumsy Child Syndrome Compilation Yvonne Tan Photos stock

  • kittie-lecroy
  • 3 Slides

xchange Does your child often fumble in his moveme...

Indian Journal of Pediatrics Volume June Original Article Correspondence and Reprint requests Dr

Indian Journal of Pediatrics Volume June Original Article Correspondence and Reprint requests Dr

  • karlyn-bohler
  • 8 Slides

Sunit Singhi Professor Head Pediatric Emergency ...

Phase III Randomized Study of Bendamustine Compared With Chlorambucil in Previously Untreated Patients With Chronic Lymphocytic Leukemia Wolfgang U

Phase III Randomized Study of Bendamustine Compared With Chlorambucil in Previously Untreated Patients With Chronic Lymphocytic Leukemia Wolfgang U

  • briana-ranney
  • 7 Slides

Knauf Toshko Lissichkov Ali Aldaoud Anna Liberati...

YALEBROWN OBSESSIVE COMPULSIVE SCALE YBOCS General Instructions This rating scale is designed to rate the severity and type of symptoms in patients with obsessive com pulsive disorder OCD

YALEBROWN OBSESSIVE COMPULSIVE SCALE YBOCS General Instructions This rating scale is designed to rate the severity and type of symptoms in patients with obsessive com pulsive disorder OCD

  • natalia-silvester
  • 21 Slides

In general the items depend on the patients repor...

Page Copyright Richard Jed Wyatt Y ALE B ROWN BSESSIVE OMPULSIVE CALE YBOCS F ORM UMMHC Ambulatory Psychiatry Plantation St Worcester MA ALE B ROWN BSESSIVE OMPULSIVE CALE YBOCS Patients name

Page Copyright Richard Jed Wyatt Y ALE B ROWN BSESSIVE OMPULSIVE CALE YBOCS F ORM UMMHC Ambulatory Psychiatry Plantation St Worcester MA ALE B ROWN BSESSIVE OMPULSIVE CALE YBOCS Patients name

  • lindy-dunigan
  • 1 Slides

Hoursday spent on obsessions 0 0 to 1 1 to 3 3 to...

Concession Certificate for Outward Journey Form for the purpose of issue of Rail Concession to Kidney Patients to be used by Officer in charge of the recognised Hospital This is to certify that Mr

Concession Certificate for Outward Journey Form for the purpose of issue of Rail Concession to Kidney Patients to be used by Officer in charge of the recognised Hospital This is to certify that Mr

  • mitsue-stanley
  • 1 Slides

Ms whose particulars are furnished below is a bon...

Patients who are confused could fall when in hospital nformation for families and carers People with confusion memory or thinking problems have an increased risk of falling when in hospital due to co

Patients who are confused could fall when in hospital nformation for families and carers People with confusion memory or thinking problems have an increased risk of falling when in hospital due to co

  • yoshiko-marsland
  • 2 Slides

A patients c ognitive impairment may be due to de...

Copyright © 2024 DocSlides. All Rights Reserved