Explore
Upload

DocSlides is a free service to upload presentations and documents.

Upload Now

Search Results for 'Databases.'

Databases. published presentations and documents on DocSlides.

With the amount of available text data in relational databases growing

With the amount of available text data in relational databases growing

  • pasty-toler
  • 12 Slides

a1 D12 a2 Eminem a4 jojo AlbumID Title b1 D12 W...

MindReader: Querying databases through multiple examples

MindReader: Querying databases through multiple examples

  • sherrill-nordquist
  • 10 Slides

Yoshiharu Ishikawat Ravishankar Subramanya Christo...

Business Research Resources

Business Research Resources

  • calandra-battersby
  • 23 Slides

Constance Adamson. Business Liaison Librarian. ad...

Keyword-based Search and Exploration on Databases

Keyword-based Search and Exploration on Databases

  • faustina-dinatale
  • 181 Slides

Yi Chen. Wei Wang. Ziyang. Liu. University of Ne...

Google vs. Library Information

Google vs. Library Information

  • myesha-ticknor
  • 12 Slides

Google Basic . Free; Too much information; . Many...

HKIEd Library

HKIEd Library

  • yoshiko-marsland
  • 48 Slides

Feb 2012. Finding Library Resources for Art-based...

Novelty/Patentability Search

Novelty/Patentability Search

  • lindy-dunigan
  • 18 Slides

What is a Novelty Search?. A novelty . (patentabi...

COMM 1018 -

COMM 1018 -

  • danika-pritchard
  • 22 Slides

Research & Resources. Megan Lowe, Coordinator...

How to Conduct a Literature Search

How to Conduct a Literature Search

  • karlyn-bohler
  • 44 Slides

By: Danielle Davidov, PhD . When to do a literat...

Introduction to Evidence-Based Health Care and the Systemat

Introduction to Evidence-Based Health Care and the Systemat

  • sherrill-nordquist
  • 155 Slides

JBI/CSRTP/2012-13/0001 . JBI-CSR Training Program...

Welcome to the

Welcome to the

  • luanne-stotts
  • 17 Slides

PGHS. Library Media Center. Library Staff consist...

DBXplorer : A System For Keyword-Based Search Over Relation

DBXplorer : A System For Keyword-Based Search Over Relation

  • pamella-moone
  • 29 Slides

Sanjay . Agrawal. M...

Library website

Library website

  • liane-varnes
  • 8 Slides

Log in . Ez. -Proxy. . Read/evaluate and Use. HO...

Finding information for your project

Finding information for your project

  • tatiana-dople
  • 21 Slides

Andrew Blackmore. Senghennydd Library. Blackmorea...

SQL Server AlwaysOn

SQL Server AlwaysOn

  • tatyana-admore
  • 21 Slides

Speaker: John Ecken. Topic: SQL Server AlwaysOn T...

Transaction Properties:

Transaction Properties:

  • myesha-ticknor
  • 12 Slides

ACID vs. BASE. ACID Properties:. Failures. Isolat...

Very Large Databases

Very Large Databases

  • alida-meadow
  • 108 Slides

Administration. @. murilocmiranda. http://www.sql...

Overview of Database Access in

Overview of Database Access in

  • sherrill-nordquist
  • 11 Slides

.Net. Josh Bowen. CIS 764-FS2008. Introduction. T...

Something Old, Something New, Something Borrowed, Tools for

Something Old, Something New, Something Borrowed, Tools for

  • danika-pritchard
  • 15 Slides

About me. Technical Services means lots of things...

Capoeira Research project

Capoeira Research project

  • tatyana-admore
  • 6 Slides

Mrs. . Caneva. Librarian. Welcome!!. Please use a...

Cyrstal

Cyrstal

  • liane-varnes
  • 14 Slides

Reports. Mohammed Wahaj. What is Crystal Reports...

Crystal Reports

Crystal Reports

  • myesha-ticknor
  • 10 Slides

Jacob Grogan. Crystal Reports and Why It’s Usef...

ECONOMIC Data MANAGEMENT

ECONOMIC Data MANAGEMENT

  • pamella-moone
  • 11 Slides

at . the IMF. Data Management Environment. Countr...

How to decide

How to decide

  • debby-jeon
  • 21 Slides

Database or Search Engine?. Margot Polley. Feb. 6...

FVAPPKR!AGGKTYFFWNEEKRRGHYPIIVLGRHA-AGRYPVVVFDAKRHFAVAPPKK

FVAPPKR!AGGKTYFFWNEEKRRGHYPIIVLGRHA-AGRYPVVVFDAKRHFAVAPPKK

  • pasty-toler
  • 37 Slides

Searching sequence databases for the entries with ...

a Virtual Research Community

a Virtual Research Community

  • ellena-manuel
  • 10 Slides

to exchange data for enumerating . the . extent o...

Novel databases for exposure to cosmetics and personal care

Novel databases for exposure to cosmetics and personal care

  • jane-oiler
  • 124 Slides

Damien . Comiskey. , Mathematical Models and Stat...

Information Literacy Workshop

Information Literacy Workshop

  • faustina-dinatale
  • 24 Slides

BIO 366: Ecology (Summer 2014). Peter Fritzler, S...

Optimizing SQL Server 2012 for SharePoint 2013

Optimizing SQL Server 2012 for SharePoint 2013

  • pamella-moone
  • 19 Slides

Brian Alderman. SES-B326. Who am I?. Brian . Alde...

The Annotated Bibliography Project:

The Annotated Bibliography Project:

  • sherrill-nordquist
  • 11 Slides

BSC Library Overview. An Anno-What? . An Annotate...

Application Express with Oracle Database 12c Multitenant Ar

Application Express with Oracle Database 12c Multitenant Ar

  • kittie-lecroy
  • 56 Slides

Source: Gartner Top Five Trends for Private Cloud...

PHAR201 Assignment 1 2012

PHAR201 Assignment 1 2012

  • natalia-silvester
  • 2 Slides

1. Assignment #1. Think about what you have learn...

BIRCH: Is

BIRCH: Is

  • jane-oiler
  • 23 Slides

I. t Good for Databases?. A review of BIRCH: An A...

CS 142 Lecture Notes: Relational Databases

CS 142 Lecture Notes: Relational Databases

  • debby-jeon
  • 13 Slides

Slide . 1. Relation (Table). name. birth. gpa. gr...

BLAST

BLAST

  • natalia-silvester
  • 11 Slides

Basic Local Alignment Search Tool. (Altschul et a...

Marketing Interlibrary Loan: A Blessing AND/OR a Curse?

Marketing Interlibrary Loan: A Blessing AND/OR a Curse?

  • conchita-marotz
  • 8 Slides

Sue Leibold. Library Director. Clarke University....

Botanical Gardens

Botanical Gardens

  • lindy-dunigan
  • 11 Slides

Team 12. Cody Boppert, . Sarath. Chandra . Yenna...

Mining Association Rules in Large Databases

Mining Association Rules in Large Databases

  • giovanna-bartolotta
  • 49 Slides

Association rules . Given a set of . transactions...

Statsky’s

Statsky’s

  • briana-ranney
  • 11 Slides

Cartwheel. American . Law professor William . S...

Small Group Communication

Small Group Communication

  • yoshiko-marsland
  • 22 Slides

Research & Resources. Presented by Megan Lowe...

Copyright © 2024 DocSlides. All Rights Reserved