PDF-A concise gene and protein repositoryPedant-Pro™ Sequence Analysi

Author : ellena-manuel | Published Date : 2016-07-07

Turn sequence data into knowledgeIn times of exponentially growing sequence data it is critical to move as quickly as possible through the project pipeline from

Presentation Embed Code

Download Presentation

Download Presentation The PPT/PDF document "A concise gene and protein repositoryPed..." is the property of its rightful owner. Permission is granted to download and print the materials on this website for personal, non-commercial use only, and to display it on your personal computer provided you do not modify the materials and that you retain all copyright notices contained in the materials. By downloading content from our website, you accept the terms of this agreement.

A concise gene and protein repositoryPedant-Pro™ Sequence Analysi: Transcript


Turn sequence data into knowledgeIn times of exponentially growing sequence data it is critical to move as quickly as possible through the project pipeline from raw sequence to protein structure and. Duane Theobald. dtheobal@westga.edu. . Before We Dive In…. http://languagelog.ldc.upenn.edu/nll/?p=4096. (. The Daily Show with Jon Stewart. -watch for language-and a good laugh!). What do these words mean to you?. WGP-1 WD™ WH™ WS™ WU WV™ WT™ NEW NEW NEW!WARTHOG MAXIMUM ER 2012CAALO Tool Talk - New Tools and New Technologies for 2012 • For Tougher Lines & Blockages• Re Marcus Chibucos, Ph.D.. University of Maryland School of Medicine. June 2014. Overview & goals. Understand. 1. How we predict . presence & structure . of coding & non-coding genes in the genome. BS, Baltimore, CTS Ontology Workshop. April 26 2012. NCBC . Scientific Ontologies Working Group. Challenge: to identify a set of scientific ontologies and ontology-related resources which can be recommended for purposes of supporting data quality and . Which of the following can be the final product of an expressed gene? . mRNA. tRNA. rRNA. polypeptide. Which of the following can be the final product of an expressed gene? . mRNA. tRNA. rRNA. polypeptide. 2. Terminology . Genome. – entire genetic material of an individual. Transcriptome. – set of transcribed sequences. Proteome. – set of proteins encoded by the genome. . Gene. * Basic . physical and functional units of heredity.. Draw 8 boxes on your paper. Gene regulation accounts for some of the phenotypic differences between organisms with similar genes.. 2005-2006. Gene regulation in bacteria. Control of gene expression enables individual bacteria to adjust their metabolism to environmental change. Manufacturer WAVi Co. Electro - Cap Trade Name WAVi Headset Electro - Cap System (K780045) Indication for Use The WAVi Headset is intended for use in routine clinical settings where rapid placement BMI/CS 776 . www.biostat.wisc.edu/bmi776/. Spring . 2018. Anthony Gitter. gitter@biostat.wisc.edu. These slides, excluding third-party material, are licensed under . CC BY-NC 4.0. by Mark Craven, Colin Dewey, and Anthony Gitter. by . Dr. Susan A. Ibrahim . What is a gene. ?. A . gene is a sequence of nucleotides in DNA . that . codes for a molecule that has a function. During gene expression, the DNA is first copied into RNA. The RNA can be directly functional or be the intermediate template for a protein that performs a function. The transmission of genes to an organism's offspring is the basis of the inheritance of phenotypic trait. These genes make up different DNA sequences called genotypes. Genotypes along with environmental and developmental factors determine what the phenotypes will be. Most biological traits are under the influence of polygenes (many different genes) as well as gene–environment interactions. Some genetic traits are instantly visible, such as eye color or number of limbs, and some are not, such as blood type, risk for specific diseases, or the thousands of basic biochemical processes that constitute life.. COVID19 is a pandemic across the world. It is caused by a novel coronavirus, severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). The Surface/Spike Glycoprotein of SARS-CoV-2, which plays a key role in the receptor recognition and cell membrane fusion process, is composed of two subunits, S1 and S2. In the present work we have searched for Surface/Spike glycoprotein in the NCBI protein database and origin from “India”, the search hit out 192 protein sequences as on 20 June 2020. Further, the sequences were aligned using Surface/Spike glycoprotein from Wuhan-China Origin and on the basis of the sequence length of 1273, the sequences were screened. Out of 192 input protein sequences, 177 sequences were complete in the length of 1273 amino-acids. Comparing all the sequences via sequence alignment mode in MEGA-X, exhibited a complex diversified outcome and reported 32 sequences. The protein sequence id QKI28685.1 was identified as a root and 31 protein sequences as a mutant/variant. QKI28685.1 was subjected to 3D protein structure modelling. As no full-length structural template was identified in the database. Automated homology modelling, Swiss-Model server and threading based I-Tasser were considered for the structure determination. Swiss-Model reported a partial structure from amino acid length 27 to 1146. A full-length structure is obtained from the I-Tasser server. The structures were analyzed using the ProSA and Ramachandran plot. 31 identified mutations were manually incorporated in the protein structure and a total of 31 mutants were created. Further, these proteins are in a process to study and understand the structural changes and their impact on the protein-protein interaction and protein-drug interaction.. the role of gene duplication followed by loss of function in speciation. For Friday, go through the slides from class 11. Aligning sequences is part of many analytical pipelines . Alignments can be local or global. Secondary structures. Tertiary structures. MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE. helices. strands. loops. Three dimensional packing of secondary structures. Protein Structures. Protein structures. ANALYSIS. PROTEIN . DATABASES. PROTEIN . SEQUENCE. MOTIF/DOMAIN. FOLDINDING. PROPERTIES. TOOLS. http://tw.expasy.org/. http://www.ebi.ac.uk/Tools/pfa/iprscan/. http://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi.

Download Document

Here is the link to download the presentation.
"A concise gene and protein repositoryPedant-Pro™ Sequence Analysi"The content belongs to its owner. You may download and print it for personal use, without modification, and keep all copyright notices. By downloading, you agree to these terms.

Related Documents