Explore
Upload

DocSlides is a free service to upload presentations and documents.

Upload Now

Search Results for 'Dp 300 : administering Relational Databases On Microsoft Azure'

Dp 300 : administering Relational Databases On Microsoft Azure published presentations and documents on DocSlides.

ECONOMIC Data MANAGEMENT

ECONOMIC Data MANAGEMENT

  • pamella-moone
  • 11 Slides

at . the IMF. Data Management Environment. Countr...

Scaling Document Management on Microsoft SharePoint 2010

Scaling Document Management on Microsoft SharePoint 2010

  • liane-varnes
  • 40 Slides

Travis Clayton. Senior Consultant. Microsoft Corp...

How to decide

How to decide

  • debby-jeon
  • 21 Slides

Database or Search Engine?. Margot Polley. Feb. 6...

Top 10 non-SharePoint Technical Issues that can doom your i

Top 10 non-SharePoint Technical Issues that can doom your i

  • calandra-battersby
  • 22 Slides

Robert Bogue. OFC-B410. Agenda. Background. Do th...

SharePoint 2010 Development Platform Overview

SharePoint 2010 Development Platform Overview

  • alexa-scheidler
  • 51 Slides

Name. Title. Corporation. Agenda. What’s New in...

Developing with Microsoft Silverlight

Developing with Microsoft Silverlight

  • briana-ranney
  • 68 Slides

Mark Johnston. Developer & Platform Group. M...

AP107 Customer Care Accelerator

AP107 Customer Care Accelerator

  • mitsue-stanley
  • 32 Slides

Ross Dembecki / Lead Product Manager. Brad Beumer...

Top 5 Free Desktop Deployment and Planning Tools for Every

Top 5 Free Desktop Deployment and Planning Tools for Every

  • jane-oiler
  • 29 Slides

AVIRAJ AJGEKAR. Technology Evangelist. Microsoft ...

SCAP Adoption at Microsoft

SCAP Adoption at Microsoft

  • myesha-ticknor
  • 25 Slides

Kelly Hengesteg, Principal Group Manager. Acceler...

Everything You Need to Know for a Successful Microsoft Offi

Everything You Need to Know for a Successful Microsoft Offi

  • luanne-stotts
  • 40 Slides

Briton Zurcher. Senior PM Manager. WIN-B330. Obje...

Better together: Application Virtualization 5.0 & Offic

Better together: Application Virtualization 5.0 & Offic

  • olivia-moreira
  • 34 Slides

Ele Ocholi. Program Manager. Microsoft. DV-B305. ...

Microsoft® System Center

Microsoft® System Center

  • briana-ranney
  • 29 Slides

Service Manager 2010. Nigel Cain . nigel.cain@mic...

Microsoft System Center

Microsoft System Center

  • conchita-marotz
  • 46 Slides

2012 Configuration . Manager . Overview. Wally Me...

Microsoft

Microsoft

  • sherrill-nordquist
  • 33 Slides

®. Learning Suite. LEARNING SUITE TOOLKITS. Cre...

Software Distribution in Microsoft System Center Configurat

Software Distribution in Microsoft System Center Configurat

  • min-jolicoeur
  • 20 Slides

v.Next. : Part 1. Agenda. Overview of Software Di...

Software Asset Management

Software Asset Management

  • mitsue-stanley
  • 21 Slides

Alastair Dick – Technology Strategist. (. alast...

Hosting Day Workshop

Hosting Day Workshop

  • jane-oiler
  • 26 Slides

ORK Introduction. Gang Pan. Microsoft. Introducti...

Automating System Center Deployment with the

Automating System Center Deployment with the

  • trish-goza
  • 59 Slides

PowerShell Deployment Toolkit. Rob Willis. Princi...

Volume Licensing Service Centre (VLSC)

Volume Licensing Service Centre (VLSC)

  • lois-ondreau
  • 8 Slides

Product Downloads: Step-by-Step Training. Septemb...

Windows 7 Device Installation Experience

Windows 7 Device Installation Experience

  • phoebe-click
  • 54 Slides

Richie Fang. Program Manager. Microsoft Corporati...

FVAPPKR!AGGKTYFFWNEEKRRGHYPIIVLGRHA-AGRYPVVVFDAKRHFAVAPPKK

FVAPPKR!AGGKTYFFWNEEKRRGHYPIIVLGRHA-AGRYPVVVFDAKRHFAVAPPKK

  • pasty-toler
  • 37 Slides

Searching sequence databases for the entries with ...

RDM Tutoriel

RDM Tutoriel

  • tatiana-dople
  • 39 Slides

de . déploiement. . rapide. Laurent Rivière. ...

SharePoint Web Part Development

SharePoint Web Part Development

  • lois-ondreau
  • 62 Slides

Best Practices. Todd C. Bleeker. Chief Software A...

Architecting a Scalable WebHosting Platform with Internet I

Architecting a Scalable WebHosting Platform with Internet I

  • conchita-marotz
  • 38 Slides

Thomas Deml. Principal Program Manager. Microsoft...

Microsoft Learning

Microsoft Learning

  • danika-pritchard
  • 60 Slides

Ignite | . May . 4 – 8. , 2015 | Chicago, IL. L...

a Virtual Research Community

a Virtual Research Community

  • ellena-manuel
  • 10 Slides

to exchange data for enumerating . the . extent o...

Driver Debugging Basics

Driver Debugging Basics

  • sherrill-nordquist
  • 47 Slides

Khalil. . Nassar. Senior Systems Engineer. Micro...

Abundantly

Abundantly "Crescent": Demos Galore

  • sherrill-nordquist
  • 20 Slides

Carolyn . Chau. Sean Boon. Lead Program . Mana...

Identity and Access Management

Identity and Access Management

  • ellena-manuel
  • 19 Slides

Decision, Analysis and Resolution (DAR) for an en...

Greg Pisocky | Sr. Business Development Manager for Accessi

Greg Pisocky | Sr. Business Development Manager for Accessi

  • myesha-ticknor
  • 71 Slides

PDF Accessibility with Adobe Acrobat X and Adobe ...

New Biometric Framework and Driver Model

New Biometric Framework and Driver Model

  • lindy-dunigan
  • 34 Slides

Dave Bossio. Principal Group Program Manager. Win...

BizTalk Adapter Pack 2.0 – All you need to know about the

BizTalk Adapter Pack 2.0 – All you need to know about the

  • jane-oiler
  • 23 Slides

Thiago Almeida. http://connectedthoughts.wordpres...

Administering the

Administering the

  • ellena-manuel
  • 15 Slides

sbac. Field Test. An Overview for Teachers. SBAC...

Trained Personnel

Trained Personnel

  • tawny-fly
  • 7 Slides

If the student is transported by bus, a school em...

Systems Administration

Systems Administration

  • cheryl-pisano
  • 29 Slides

Sub-Committee. Planning, Budgeting, and Accountab...

Saher Hirji

Saher Hirji

  • olivia-moreira
  • 16 Slides

Global Digital Marketing Lead. Microsoft Affiliat...

Novel databases for exposure to cosmetics and personal care

Novel databases for exposure to cosmetics and personal care

  • jane-oiler
  • 124 Slides

Damien . Comiskey. , Mathematical Models and Stat...

Information Literacy Workshop

Information Literacy Workshop

  • faustina-dinatale
  • 24 Slides

BIO 366: Ecology (Summer 2014). Peter Fritzler, S...

Optimizing SQL Server 2012 for SharePoint 2013

Optimizing SQL Server 2012 for SharePoint 2013

  • pamella-moone
  • 19 Slides

Brian Alderman. SES-B326. Who am I?. Brian . Alde...

for Business

for Business

  • celsa-spraggs
  • 2 Slides

Rev. 1 307 C Microsoft

Copyright © 2024 DocSlides. All Rights Reserved