PPT-SVYDAAAQLTADVKKDLRDSWDLVCS

PPT-SVYDAAAQLTADVKKDLRDSWDLVCS thumbnail
Phyre2 One to o ne threading Extract sequence and s econdary structure information HMM of User structure PSIBlast vs sequence database hmmhmm matching User structure

Download Presentation

"SVYDAAAQLTADVKKDLRDSWDLVCS" is the property of its rightful owner. Permission is granted to download and print materials on this website for personal, non-commercial use only, provided you retain all copyright notices. By downloading content from our website, you accept the terms of this agreement.

Presentation Transcript

Transcript not available.

Related Topics